PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK36518.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 163aa    MW: 19010.2 Da    PI: 6.2737
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK36518.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.31.6e-1371121454
                 XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                 ++++r+k++NRe+ArrsR RK+ +++eL   v  L +eN++L  +l++  +
  KFK36518.1  71 DRKQRKKISNRESARRSRMRKQRQLDELWSQVMWLRNENHQLLHKLNRVLE 121
                 789******************************************998755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-1265132IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.48470133IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.4E-1070122No hitNo description
PfamPF001705.8E-1171122IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.53E-1172121No hitNo description
CDDcd147027.90E-1773121No hitNo description
PROSITE patternPS0003607590IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MQPSTDIFSL HGSAPSYFSP FPISSPFRVN GITPNTFYSF QTGVNNPQSM TLSSNSTSDE  60
AEENQEDIVN DRKQRKKISN RESARRSRMR KQRQLDELWS QVMWLRNENH QLLHKLNRVL  120
ESQEKVVEEN AQLKEEAVEL KQMISDMQLQ NQSPFSCFRD DIV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18491RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00533DAPTransfer from AT5G38800Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006405699.13e-92hypothetical protein EUTSA_v10028235mg
SwissprotQ9FMC24e-86BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A087H3161e-118A0A087H316_ARAAL; Uncharacterized protein
STRINGAT5G38800.11e-83(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G38800.12e-78basic leucine-zipper 43